PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013627119.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 231aa    MW: 25482.6 Da    PI: 4.5733
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013627119.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601361.4e-4254151198
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r+d+++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+la
  XP_013627119.1  54 PCAACKILRRRCAEKCVLAPYFPPTDPAKFIIAHRVFGASNIIKFLQELPESQRTDTVNSMVYEAGARMRDPVYGCAGAIYHLQRQVCELQAQLA 148
                     7*********************************************************************************************9 PP

          DUF260  96 llk 98 
                     +++
  XP_013627119.1 149 KTQ 151
                     987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.0253154IPR004883Lateral organ boundaries, LOB
PfamPF031956.2E-4254151IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MLKMETFGGI SVAAPTSSAV EKTTTPANSA SPTSSPPPPL SPEQPQQQTV VLSPCAACKI  60
LRRRCAEKCV LAPYFPPTDP AKFIIAHRVF GASNIIKFLQ ELPESQRTDT VNSMVYEAGA  120
RMRDPVYGCA GAIYHLQRQV CELQAQLAKT QVDLVSMQLQ RSDLLELLHK TEQANLSEQQ  180
EGQQNMSFES SFESGDEFIS SHDEVTNDLG FLDDNNNNNN SSMLWSDPLW T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2409850.0AC240985.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB008O16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627119.11e-174PREDICTED: LOB domain-containing protein 11-like
SwissprotQ9SK081e-121LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0D3B7981e-174A0A0D3B798_BRAOL; Uncharacterized protein
STRINGBra000491.1-P1e-171(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-103LOB domain-containing protein 11